PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00261.1.g00330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 323aa    MW: 34483 Da    PI: 6.7768
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00261.1.g00330.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.11e-181562148
                                    TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                    +g+WT+eEd+llvd++++ G ++W++ ++  g++R++k+c++rw +yl
  Zmw_sc00261.1.g00330.1.sm.mkhc 15 KGPWTPEEDKLLVDYIQKNGHRSWRRLPKLAGLNRCGKSCRLRWTNYL 62
                                    79********************************************97 PP

2Myb_DNA-binding55.31.5e-1768113148
                                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                     rg +T eE++l+++++  lG++ W++Ia +++ gRt++++k++w+++l
  Zmw_sc00261.1.g00330.1.sm.mkhc  68 RGQFTDEEEKLIIHLHSVLGNK-WSSIATKLP-GRTDNEIKNYWNTHL 113
                                     899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.0671062IPR017930Myb domain
SuperFamilySSF466891.17E-3012109IPR009057Homeodomain-like
SMARTSM007171.1E-141464IPR001005SANT/Myb domain
PfamPF002493.5E-171562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-241669IPR009057Homeodomain-like
CDDcd001678.41E-121762No hitNo description
PROSITE profilePS5129427.76563117IPR017930Myb domain
SMARTSM007178.1E-1667115IPR001005SANT/Myb domain
PfamPF002494.3E-1668113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.5E-2770117IPR009057Homeodomain-like
CDDcd001677.38E-1371113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MGRSPCCDQE SGVKKGPWTP EEDKLLVDYI QKNGHRSWRR LPKLAGLNRC GKSCRLRWTN  60
YLRPDIKRGQ FTDEEEKLII HLHSVLGNKW SSIATKLPGR TDNEIKNYWN THLRKKLLNM  120
GIDPVTHRPR TDLDLLAGLP NSNLLAAASN TTWDINALKL QADAAKFQLL QGLISAIAAA  180
AAPSVDLMAL LAASSAGLTQ TVSVDRGSSR SSQYDGFMNL PALTTAPTVS PGMTSFVGLL  240
NGFIGGSAHA GDGLSSTDLG QSGASGSSMT AAMAPPLVAA VACNAGAGVA TPCEETPASS  300
PFEELENLNL DDLSNDSWKD LLE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-31151174105MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-31151174105C-Myb DNA-Binding Domain
1msf_C1e-31151174105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964317.11e-163PREDICTED: transcription factor MYB39-like
TrEMBLK3XXY21e-163K3XXY2_SETIT; Uncharacterized protein
STRINGSi006790m1e-162(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP55293158